(a)	All the residues are colored in black; however, those residues in template which are identical to the residue in the query sequence are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade. (more about the colors used)
(b)	Rank of templates represents the top ten threading templates used by I-TASSER.
(c)	Ident1 is the percentage sequence identity of the templates in the threading aligned region with the query sequence.
(d)	Ident2 is the percentage sequence identity of the whole template chains with query sequence.
(e)	Cov. represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein.
(f)	Norm. Z-score is the normalized Z-score of the threading alignments. Alignment with a Normalized Z-score >1 mean a good alignment and vice versa.
(g)	Download Align. provides the 3D structure of the aligned regions of the threading templates.
(h)	The top 10 alignments reported above (in order of their ranking) are from the following threading programs:
	1: SP3 2: PPA-I 3: SPARKS 4: SP3 5: PPA-I 6: SPARKS 7: SP3 8: PPA-I 9: SPARKS 10: SP3

10 proteins in PDB which are structurally closest to the first I-TASSER model (identified by TM-align)

Rank	TM-score	RMSD^a	IDEN^a	Cov.	PDB Hit
1	0.9846	0.06	0.10	1.00	1jipA Model1

2	0.9841	0.06	0.00	1.00	2jmhA Model1

3	0.9836	0.06	0.10	1.00	2fckA Model1

4	0.9806	0.07	0.10	1.00	1nrjB Model1

5	0.9781	0.08	0.20	1.00	1jb9A Model1

6	0.9778	0.08	0.00	1.00	2fmyA Model1

7	0.9771	0.08	0.10	1.00	1di2A Model1

8	0.9771	0.08	0.00	1.00	1ni9A Model1

9	0.9760	0.08	0.10	1.00	1jhgA Model1

10	0.9757	0.08	0.00	1.00	3e8oA Model1

Structural alignment using TM-align
TTVPDLESDSFHVDWYRTYAELRETAPVTPVRFLGQDAWLVTGYDEAKAALSDLRLSSDPKKKYPGVEVEFPAYLGFPEDVRNYFATNMGTSDPPTHTRLRKLVSQEFTVRRVEAMRPRVEQITAELLDEVGDSGVVDIVDRFAHPLPIKVICELLGVDEKYRGEFGRWSSEILVMDPERAEQRGQAAREVVNFILDLVERRRTEPGDDLLSALIRVQDDDDGRLSADELTSIALVLLLAGFESSVSLIGIGTYLLLTHPDQLALVRRDPSALPNAVEEILRYIAPPETTTRFAAEEVEIGGVAIPQYSTVLVANGAANRDPKQFPDPHRFDVTRDTRGHLSFGQGIHFCMGRPLAKLEGEVALRALFGRFPALSLGIDADDVVWRRSLLLRGIDHLPVRLDG -----------------------------------------------------------------------------------------------------------------------AIVQTLVNSV----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

QEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ ------------------------------------------------------------------------------------------------------AIVQTLVNSV-----

TPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGVAINEFYHTFNASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIP --------------------------------------------AIVQTLVNSV---------------------------------------------------------------------------------------------------------------------

SYQPSIIIAGPQNSGKTSLLTLLTTDSVRPTVVSQEPLSAADYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERRKKSLNELDVLGFKFANLEASVVAFEGSINKRKISQWREWIDEKL ---------------------------------------------------------------------------------------------------------------------------------------------AIVQTLVNSV----------------------------------------

DPNATHIMIATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFRYDKALSREQKGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY ------------------------------------------------------------------------------------------------------------------AIVQTLVNSV--------------------------

FKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS ----AIVQTLVNSV---------------------------------------------------------------------

MPVGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVETFVETGSGTSKQVAKRVAAEKLLTKFKT ------------------------------------------------------AIVQTLVNSV-----

GCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLAGIEAGKVLRLGDMAR -------------------------------AIVQTLVNSV-------------------------------------------------------------------------------------------------

SAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIIEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD ----AIVQTLVNSV---------------------------------------------------------------------------------------

TVISHGTLSASAEHAAHLRQLLVHIAQATRQEDGCLLYLVSEDLSQPGHFLITEHWDNLGAHTHLALPGVTQAIDALKHLNVTDLKITAYEAGEAINIG ------------------AIVQTLVNSV-----------------------------------------------------------------------

(a)	Residue pairs that are structurally aligned by TM-align program are highlighted in color. Coloring scheme is based on the property of amino acids, where polar are brightly coloured while non-polar residues are colored in dark shade.(more about the colors used)
(b)	Ranking of proteins is based on TM-score of the structural alignment between Model1 and the PDB structures in our template library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the model.

Function Prediction

Predicted EC Numbers

Rank	TM-score	RMSD^a	IDEN^a	Cov.	EC-Score	PDB Hit	EC No.
1	0.8259	0.23	0.70	1.00	3.3141	1lx5A	2.7.11.30

2	0.9443	0.12	0.50	1.00	2.8610	1u52A	3.1.4.4

3	0.9097	0.16	0.50	1.00	2.8126	2riiY	1.8.98.2

4	0.9594	0.10	0.40	1.00	2.5842	1nu3B	3.3.2.8

5	0.9302	0.14	0.40	1.00	2.5390	1z7gA	2.4.2.8

(a)	Ranking is based on EC-score, which is a confidence score for the Enzyme Classification (EC) Number prediction.
(b)	RMSD^a is the RMSD between models and the PDB structure in the structurally aligned regions by TM-align.
(c)	IDEN^a is percentage sequence identity in the structurally aligned region.
(d)	Cov. represents the coverage of the alignment and is equal to the number of structurally aligned residues divided by length of model.
(e)	EC-Score is defined based on the C-score of the structure prediction and similarity of the model with known enzyme structures, as identified using both global and local structural alignment programs. The global similarity score uses TM-score, IDEN^a,RMSD^a and Cov. of the structural alignment by TM-align, while the local match compares the structural and chemical similarity of local spatial motifs in the model with known catalytic site of enzymes. A prediction with a EC-score >1.1 signifies a prediction with high confidence (upto 3 digit numbers of EC) and vice versa (For details, see Ambrish, Kucukural and Zhang,Large scale benchmarking of protein function prediction using predicted protein structures, 2009, submitted).

Predicted GO terms

Rank	TMscore	RMSD^a	IDEN^a	Cov.	PDB Hit	Fh-Score	Associated GO Terms
1	0.8493	0.23	0.70	1.00	1m4uL	3.33	GO:0005125 GO:0008083 GO:0008201 GO:0030246 GO:0008283 GO:0009653 GO:0010926 GO:0032501 GO:0040007 GO:0044237 GO:0048869 GO:0050789 GO:0051179 GO:0065007 GO:0005576 GO:0005615
2	0.8958	0.18	0.60	1.00	2bhkA	3.09	GO:0005125 GO:0008083 GO:0009653 GO:0009987 GO:0032501 GO:0040008 GO:0050789 GO:0065007 GO:0005576 GO:0005615
3	0.9387	0.13	0.50	1.00	1v0yA	2.85	GO:0004620 GO:0004630 GO:0008152
4	0.8802	0.19	0.50	1.00	2gzwD	2.77	GO:0003677 GO:0003700 GO:0005515 GO:0030551 GO:0030552 GO:0030554 GO:0006139 GO:0009058 GO:0009889 GO:0009987 GO:0043283 GO:0044249 GO:0044260 GO:0050794 GO:0060255 GO:0065007 GO:0005622 GO:0005623
5	0.8650	0.20	0.50	1.00	1kfwA	2.76	GO:0004568 GO:0030246 GO:0043169 GO:0006032 GO:0006044 GO:0006046 GO:0009056 GO:0043283 GO:0005576
6	0.8340	0.23	0.50	1.00	2ckxA	2.72	GO:0003677 GO:0006139 GO:0009058 GO:0009889 GO:0009987 GO:0043283 GO:0044249 GO:0044260 GO:0050794 GO:0060255 GO:0065007 GO:0005622 GO:0005623 GO:0005634 GO:0043229 GO:0044424
7	0.8307	0.24	0.50	1.00	1vkoA	2.71	GO:0004512 GO:0005488 GO:0009987 GO:0032501 GO:0032502 GO:0040008 GO:0040011 GO:0044237 GO:0050789 GO:0065007
8	0.9473	0.12	0.40	1.00	1xvhA	2.56	GO:0005515 GO:0009405 GO:0005623 GO:0005886 GO:0016021
9	0.9471	0.12	0.40	1.00	2ikqM	2.56	GO:0005622 GO:0005623 GO:0005634 GO:0005737 GO:0043229
10	0.9407	0.13	0.40	1.00	1yxmD	2.55	GO:0005488 GO:0019166 GO:0009058 GO:0009987 GO:0016265 GO:0044237 GO:0044238 GO:0050793 GO:0050794 GO:0055114 GO:0065007 GO:0005622 GO:0005623 GO:0005737 GO:0005739 GO:0005777 GO:0043229 GO:0044444

Consensus Prediction of Gene Ontology terms

Molecular Function    Biological Process Cellular Location

GO term GO-Score    GO term GO-Score GO term GO-Score

GO:0005515 1.096    GO:0009987 2.124    GO:0005623 2.175

GO:0016787 0.786    GO:0065007 1.239    GO:0005622 1.920

GO:0016740 0.508    GO:0032502 0.965    GO:0005737 1.395

GO:0046872 0.506    GO:0044260 0.930    GO:0043229 1.274

GO:0003676 0.402    GO:0009058 0.908    GO:0044444 0.759

GO:0008083 0.321    GO:0043283 0.793    GO:0005634 0.515

GO:0005102 0.321    GO:0050794 0.655    GO:0005886 0.508

GO:0005125 0.321    GO:0032501 0.584    GO:0005576 0.459

GO:0030246 0.304    GO:0040008 0.580    GO:0044425 0.381

GO:0003677 0.275    GO:0006139 0.528    GO:0005739 0.380

(a) Ranking in the first table is based on a function prediction score (Fh-score), which is calculated based on the C-score of the structure prediction and the TM-score, IDEN^a, RMSD^a and Cov. of the structural alignment by TM-align between the predicted model and the PDB structures (For details, see Ambrish, Kucukural and Zhang,Large scale benchmarking of protein function prediction using predicted protein structures, 2009, submitted).

(b) RMSD^a is the RMSD between models and the PDB structure in the structurally aligned regions by TM-align.

(c) IDEN^a is the percentage sequence identity in the structurally aligned region.

(d) Cov. represents the coverage of the alignment and is equal to the number of structurally aligned residues divided by length of model.

(e) A consensus prediction of GO terms is derived from the structural analogs that have an Fh-score of >=1.0. The GO-Score associated with each prediction is defined as the average weight of the GO term, where the weights are assigned based on the Fh-score of the template from which the GO term is derived. A prediction with a GO-score >0.5 signifies a prediction with high confidence and vice versa.

Predicted Binding Site

No binding site residues were found in the predicted structure.

	Please cite following articles when you use the I-TASSER server:
1.	Yang Zhang. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics, 9:40 (2008).
2.	Yang Zhang. Template-based modeling and free modeling by I-TASSER in CASP7. Proteins, 8: 108-117 (2007).
3.	Sitao Wu, Jeffrey Skolnick, Yang Zhang. Ab initio modeling of small proteins by iterative TASSER simulations. BMC Biology, 5:17 (2007).